Pay in 4 interest-free payments of $302.75 Learn more
Ships within 48 hours · Estimated delivery Aug 9 - Aug 14
Azaheterocycle hydroxylase (EC:1
000bp fragment are 100ng
mitochondrial Alternative name(s): Protein PM1
AA Sequence:MELLTNFPLLSSLAAIIFAQVIKVPIQFIVSRKLDWSLVTSTGGMPSSHSAAVTALSTGV ALEHGLDSSLFAVSAIFAVITMFDATGVRRHAGEQATVINKLVIDFNRFVNEAKDFPKAA EKEKQKKLKELLGHQPIEVFFGGLTGILLTLVLAYFFM
Recombinant Xenopus laevis Apoptosis-inducing factor 2(aifm2) Plasmid Kit Azaheterocycle hydroxylase (EC:1Size: 50 ug. Other sizes are also available. Please Inquire. Product Type: Recombinant Protein Species: Xenopus laevis (African clawed frog) Uniprot NO.: Q6GLW8 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4
